Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RanBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
Antigen | RanBP2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RanBP2 Polyclonal specifically detects RanBP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RanBP2 | |
Polyclonal | |
Rabbit | |
Human | |
ANE1, E3 SUMO-protein ligase RanBP2, EC 5.2.1.8, Nuclear pore complex protein Nup358, nucleoporin 358, Nucleoporin Nup358, NUP358TRP2, P270, RAN binding protein 2, Ran-binding protein 2, RanBP2, transformation-related protein 2,358 kDa nucleoporin, TRP1 | |
RANBP2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5903 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title