Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RANBP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32140625UL
Description
RANBP9 Polyclonal antibody specifically detects RANBP9 in Human samples. It is validated for ImmunofluorescenceSpecifications
RANBP9 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
BPM90, BPM-L, RAN binding protein 9, Ran Binding Protein in the Microtubule organizing center, ran binding protein, centrosomal, ran-binding protein 9, Ran-binding protein M, RanBP7, RanBP9, RanBPM, RANBPMnovel centrosomal protein RanBPM | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS | |
25 μg | |
Cell Biology, Cell Cycle and Replication | |
10048 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction