Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAP30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317980
This item is not returnable.
View return policy
Description
RAP30 Polyclonal antibody specifically detects RAP30 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
RAP30 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
ATP-dependent helicase GTF2F2, BTF4, General transcription factor IIF 30 kDa subunit, general transcription factor IIF subunit 2, general transcription factor IIF, polypeptide 2, 30kDa, TF2F2, TFIIF, TFIIF-beta, Transcription initiation factor IIF subunit beta, Transcription initiation factor RAP30 | |
The immunogen is a synthetic peptide directed towards the middle region of human RAP30. Peptide sequence: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ The peptide sequence for this immunogen was taken from within the described region. | |
0.1 mL | |
Chromatin Research | |
2963 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, 2% Sucrose | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human, Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction