RAPGEF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157045

Catalog No. NBP157045

Description

RAPGEF3 Polyclonal specifically detects RAPGEF3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RAPGEF3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 9330170P05Rik, bcm910, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I, CGEF1, EPAC 1, EPAC1, EPACRAP guanine-nucleotide-exchange factor (GEF) 3, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, HSU79275, MGC21410, Rap guanine nucleotide exchange factor (GEF) 3, rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 91%; Rabbit: 84%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95398
• Gene Symbols: RAPGEF3
• Immunogen: Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3. Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10411
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.