Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89968816

Abnova™ RARRES2 Recombinant Protein

Catalog No. 89968816
Click to view available options
:
2 μg

Description

Used for AP, Array, ELISA, WB-Re

Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Specifications

Accession Number NP_002880.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH = 8.0 in the elution buffer.
Gene ID (Entrez) 5919
Molecular Weight (g/mol) 41.8 kDa
Name RARRES2 (Human) Recombinant Protein (P02)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Immunogen VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CHEMERIN, HP10433, TIG2
Common Name RARRES2
Gene Symbol RARRES2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System Wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.