RASGRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15887120UL

Catalog No. NBP1588720

Description

RASGRP2 Polyclonal specifically detects RASGRP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RASGRP2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q7LDG7
• Gene Symbols: RASGRP2
• Immunogen: Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Calcium and DAG-regulated guanine nucleotide exchange factor I, CALDAG-GEFI, CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I, Cdc25-like protein, F25B3.3 kinase-like protein, guanine exchange factor MCG7, hCDC25L, MCG7, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), RAS guanyl-releasing protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10235
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.