Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASGRP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | RASGRP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1588720
|
Novus Biologicals
NBP15887120UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP158871
|
Novus Biologicals
NBP158871 |
100 μL |
Each for $487.50
|
|
|||||
Description
RASGRP2 Polyclonal specifically detects RASGRP2 in Human samples. It is validated for Western Blot.Specifications
| RASGRP2 | |
| Polyclonal | |
| Rabbit | |
| Q7LDG7 | |
| 10235 | |
| Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Calcium and DAG-regulated guanine nucleotide exchange factor I, CALDAG-GEFI, CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I, Cdc25-like protein, F25B3.3 kinase-like protein, guanine exchange factor MCG7, hCDC25L, MCG7, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), RAS guanyl-releasing protein 2 | |
| RASGRP2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title