Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASGRP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RASGRP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1588720
|
Novus Biologicals
NBP15887120UL |
20 μL |
Each for $152.22
|
|
NBP158871
|
Novus Biologicals
NBP158871 |
100 μL |
Each for $436.00
|
|
Description
RASGRP2 Polyclonal specifically detects RASGRP2 in Human samples. It is validated for Western Blot.Specifications
RASGRP2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Calcium and DAG-regulated guanine nucleotide exchange factor I, CALDAG-GEFI, CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I, Cdc25-like protein, F25B3.3 kinase-like protein, guanine exchange factor MCG7, hCDC25L, MCG7, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), RAS guanyl-releasing protein 2 | |
RASGRP2 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q7LDG7 | |
10235 | |
Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title