Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASGRP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325094
Description
RASGRP3 Polyclonal antibody specifically detects RASGRP3 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
RASGRP3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Calcium and DAG-regulated guanine nucleotide exchange factor III, GRP3KIAA0846ras guanyl-releasing protein 3, Guanine nucleotide exchange factor for Rap1, RAS guanyl releasing protein 3 (calcium and DAG-regulated) | |
This antibody has been engineered to specifically recognize the recombinant protein RASGRP3 using the following amino acid sequence: AITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGE | |
100 μL | |
Phospho Specific | |
25780 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction