RASL10A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP234210

Catalog No. NBP234210

Description

RASL10A Polyclonal specifically detects RASL10A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RASL10A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q92737
• Gene Symbols: RASL10A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10633
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ras-like protein family member 10A, RAS-like, family 10, member A, RAS-related on chromosome 22, Ras-related protein on chromosome 22, RRP22Ras-like protein RRP22
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only