RASL10B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP213205

Catalog No. NBP213205

Description

RASL10B Polyclonal specifically detects RASL10B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RASL10B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: MGC47540, Ras-like protein VTS58635, RAS-like, family 10, member B, Ras-related protein 17, RRP17ras-like protein family member 10B, VTS58635
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RASL10B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 91608
• Target Species: Human
• Isotype: IgG

For Research Use Only