Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASL11A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25864125UL
Description
RASL11A Polyclonal specifically detects RASL11A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RASL11A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Ras-Like Protein Family Member 11A, RAS-Like, Family 11, Member A | |
Rabbit | |
Affinity Purified | |
RUO | |
387496 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
RASL11A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQH | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction