Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASL12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RASL12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RASL12 Polyclonal specifically detects RASL12 in Human samples. It is validated for Western Blot.Specifications
RASL12 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
Ras family member Ris, ras-like protein family member 12, RAS-like, family 12, RISRas-like protein Ris | |
RASL12 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NYN1 | |
51285 | |
Synthetic peptides corresponding to RASL12(RAS-like, family 12) The peptide sequence was selected from the N terminal of RASL12. Peptide sequence MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title