Invitrogen™ RbAp48 Monoclonal Antibody (9F3)

Catalog No.	Quantity
PIMA533003	100 μg

Catalog No. PIMA533003 Supplier Invitrogen™ Supplier No. MA533003

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Jurkat whole cell, rat thymus tissue, mouse spleen tissue, human A549 whole cell, human Jurkat whole cell, human Hela whole cell, human PANC-1 whole cell. IHC: human intestinal cancer tissue, human placenta tissue, human mammary cancer tissue, human intestinal cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue. Flow: SiHa cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.

Specifications

• Antigen: RbAp48
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Classification: Monoclonal
• Clone: 9F3
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: RBBP4
• Gene Accession No.: Q09028, Q60972
• Gene Alias: CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; histone-binding protein RBBP4; lin-53; mRbAp48; MSI1 protein homolog; nucleosome-remodeling factor subunit RBAP48; NURF55; RB binding protein 4, chromatin remodeling factor; RBAP48; RBBP4; RBBP-4; retinoblastoma binding protein 4; retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48
• Gene Symbols: RBBP4
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 19646, 313048, 5928
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG1