Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBBP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RBBP6 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBBP6 Polyclonal specifically detects RBBP6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RBBP6 | |
Polyclonal | |
Rabbit | |
Tumor Suppressors | |
E3 ubiquitin-protein ligase RBBP6, EC 6.3.2.-, MY038, P2PR, P2P-R, p53-associated cellular protein of testis, PACTDKFZp761B2423, Proliferation potential-related protein, Protein P2P-R, RB-binding Q-protein 1, RBQ1, RBQ-1, retinoblastoma binding protein 6, Retinoblastoma-binding protein 6DKFZp686P0638, Retinoblastoma-binding Q protein 1, SNAMA | |
RBBP6 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
5930 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title