Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBBP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RBBP9 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBBP9 Polyclonal specifically detects RBBP9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RBBP9 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10741 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
B5T-overexpressed gene protein, Bog, BOGB5T overexpressed gene protein, EC 3.-, Protein BOG, putative hydrolase RBBP9, RBBP10, RBBP-10, RBBP-9, retinoblastoma binding protein 9, Retinoblastoma-binding protein 10, Retinoblastoma-binding protein 9MGC9236, retinoma-binding protein 9 | |
RBBP9 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title