Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RBCK1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200039005 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP188301 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP188301 Supplier Novus Biologicals Supplier No. NBP188301
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

RBCK1 Polyclonal specifically detects RBCK1 in Human, Mouse samples. It is validated for Western Blot, Immunoblotting.

Specifications

Antigen RBCK1
Applications Western Blot, Immunoblot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunoblotting
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C20orf18, EC 6.3.2.-, HBV associated factor 4, HBV-associated factor 4, Heme-oxidized IRP2 ubiquitin ligase 1, Hepatitis B virus X-associated protein 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4
Gene Symbols RBCK1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 10616
Test Specificity Specificity of human RBCK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.