Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBED1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | RBED1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBED1 Polyclonal specifically detects RBED1 in Human samples. It is validated for Western Blot.Specifications
| RBED1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29 | |
| ELMOD3 | |
| IgG | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_115589 | |
| 84173 | |
| Synthetic peptide directed towards the C terminal of human ELMOD3. Peptide sequence FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title