Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RBM22 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBM22 Polyclonal specifically detects RBM22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RBM22 | |
Polyclonal | |
Rabbit | |
Q9NW64 | |
55696 | |
Synthetic peptides corresponding to RBM22(RNA binding motif protein 22) The peptide sequence was selected from the C terminal of RBM22. Peptide sequence KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Cwc2, FLJ10290, fSAP47, functional spliceosome-associated protein 47, pre-mRNA-splicing factor RBM22, RNA binding motif protein 22, ZC3H16RNA-binding motif protein 22, Zinc finger CCCH domain-containing protein 16 | |
RBM22 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title