Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RBM24 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBM24 Polyclonal specifically detects RBM24 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
RBM24 | |
Polyclonal | |
Rabbit | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
221662 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6 | |
RBM24 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title