RBM25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257656

Catalog No. NBP257656

Description

RBM25 Polyclonal specifically detects RBM25 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RBM25
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-binding motif protein 25, RNA-binding protein 25, RNA-binding region (RNP1, RRM) containing 7, RNPC7, S164, Snu71, U1 small nuclear ribonucleoprotein 1SNRP homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 58517
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RBM25
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only