Learn More
Description
Specifications
Specifications
| Antigen | RBM25 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-binding motif protein 25, RNA-binding protein 25, RNA-binding region (RNP1, RRM) containing 7, RNPC7, S164, Snu71, U1 small nuclear ribonucleoprotein 1SNRP homolog |
| Gene Symbols | RBM25 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
