RBM46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180475

Catalog No. NBP180475

Description

RBM46 Polyclonal specifically detects RBM46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBM46
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 68, CT68MGC27016, probable RNA-binding protein 46, RNA binding motif protein 46, RNA-binding motif protein 46
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 166863
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_659416
• Gene Symbols: RBM46
• Immunogen: Synthetic peptide directed towards the N terminal of human MGC27016. Peptide sequence LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Bovine: 100%; Canine: 100%; Mouse: 100%; Crab-eating macaque: 100%; Chicken: 85%; African malaria mosquito: 84%; Yellowfever mosquito: 84%; Harpegnathos saltator: 84%; Zebrafish: 76%; Western clawed frog: 76%; Florida lancelet: 76%; Green puffer: 76%; Slime mold: 76%; Sumatran orangutan: 76%; Human: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG