Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18047520UL
Description
RBM46 Polyclonal specifically detects RBM46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RBM46 | |
| Polyclonal | |
| Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| NP_659416 | |
| RBM46 | |
| Synthetic peptide directed towards the N terminal of human MGC27016. Peptide sequence LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| Cancer/testis antigen 68, CT68MGC27016, probable RNA-binding protein 46, RNA binding motif protein 46, RNA-binding motif protein 46 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 166863 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction