Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18047020UL
Description
RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.Specifications
C7orf64 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_115496 | |
RBM48 | |
Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48 | |
Rabbit | |
Affinity Purified | |
RUO | |
84060 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction