Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RBM48 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18047020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18047020 20 μL
NBP180470 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18047020 Supplier Novus Biologicals Supplier No. NBP18047020UL

Rabbit Polyclonal Antibody

RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.

Specifications

Antigen C7orf64
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_115496
Gene Alias C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48
Gene Symbols RBM48
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84060
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.