Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | C7orf64 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18047020
![]() |
Novus Biologicals
NBP18047020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP180470
![]() |
Novus Biologicals
NBP180470 |
100 μL |
Each for $487.50
|
|
|||||
Description
RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.Specifications
C7orf64 | |
Polyclonal | |
Rabbit | |
NP_115496 | |
84060 | |
Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48 | |
RBM48 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title