RBM7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157429

Catalog No. NBP157429

Description

RBM7 Polyclonal specifically detects RBM7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBM7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ11153, RNA binding motif protein 7, RNA-binding motif protein 7, RNA-binding protein 7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10179
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9Y580
• Gene Symbols: RBM7
• Immunogen: Synthetic peptides corresponding to RBM7(RNA binding motif protein 7) The peptide sequence was selected from the middle region of RBM7. Peptide sequence SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85%; Bovine: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only