RBM8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB418133	Novus Biologicals NBP18837625UL	25 μL
NBP188376	Novus Biologicals NBP188376	0.1 mL

Description

RBM8A Polyclonal specifically detects RBM8A in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: RBM8A
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Alias: Binder of OVCA1-1, BOV-1, BOV-1A, BOV-1B, BOV-1C, MDS014, RBM8BRBM8, ribonucleoprotein RBM8, Ribonucleoprotein RBM8A, RNA binding motif protein 8A, RNA binding motif protein 8B, RNA-binding motif protein 8A, RNA-binding protein 8A, RNA-binding protein Y14, Y14, ZNRP, ZRNP1
• Gene Symbols: RBM8A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9939
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only