RBMS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18949725UL

Catalog No. NB430645

Description

RBMS3 Polyclonal specifically detects RBMS3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBMS3
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: RNA binding motif, single stranded interacting protein 3, RNA-binding protein, single stranded interacting protein, single-stranded-interacting protein 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27303
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RBMS3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human RBMS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only