Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBPMS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RBPMS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBPMS Polyclonal specifically detects RBPMS in Human samples. It is validated for Western Blot.Specifications
RBPMS | |
Polyclonal | |
Rabbit | |
DNA Repair, Mismatch Repair | |
FLJ32971, Heart and RRM expressed sequence, Hermes, HERMESRNA-binding protein with multiple splicing, RBP-MS, RNA binding protein with multiple splicing | |
RBPMS | |
IgG | |
22 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q93062 | |
11030 | |
Synthetic peptide directed towards the N terminal of human RBPMS (NP_001008710). Peptide sequence RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title