RCAN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158949

Catalog No. NBP158949

Description

RCAN3 Polyclonal specifically detects RCAN3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RCAN3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: RCAN3
• Immunogen: Synthetic peptides corresponding to RCAN3(RCAN family member 3) The peptide sequence was selected from the middle region of RCAN3. Peptide sequence PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA.
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 11123
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5, hRCN3, Myocyte-enriched calcineurin-interacting protein 3, RCAN family member 3, RCN3, Regulator of calcineurin 3, regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2, regulator of calcineurin 3 isoform 1b2,34,5, regulator of calcineurin 3 isoform 1c2,34,5, regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Chicken: 92%; Mouse: 92%; Rat: 92%; Pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG