Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human 14-3-3 beta/alpha Protein
SDP

Catalog No. NBC118405 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118405 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118405 Supplier Novus Biologicals™ Supplier No. NBC118405
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-246 of Human 14-3-3 beta/alpha The Recombinant Human 14-3-3 beta/alpha Protein is derived from E. coli. The Recombinant Human 14-3-3 beta/alpha Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_003395
For Use With (Application) Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunoprecipitation, SDS-PAGE, Western Blot
Formulation 20mM Tris buffer (pH 8.0), 1mM EDTA, 50mM NaCl
Gene ID (Entrez) 7529
Molecular Weight (g/mol) 28kDa
Name 14-3-3 beta/alpha Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >90%
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.