Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Click to view available options
Quantity:
100 μg
200 μg
500 μg
Description
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
Specifications
Specifications
For Use With (Application) | In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot |
Formulation | PBS |
Gene ID (Entrez) | 6622 |
Name | Human alpha-Synuclein Aggregate Protein |
Purification Method | >95% pure by SDS-PAGE |
Quantity | 500 μg |
Source | E.Coli |
Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Storage Requirements | Store at -80°C. Avoid freeze/thaw cycles. |
Regulatory Status | RUO |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction