Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Protein
Shop All R&D Systems Products

Click to view available options
Quantity:
0.1 mg
Description
An un-tagged recombinant protein corresponding to the amino acids 1-140 of Human alpha-Synuclein The Recombinant Human alpha-Synuclein Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
| Accession Number | NP_000336.1 |
| For Use With (Application) | ELISA, SDS-PAGE |
| Formulation | 20mM Tris-HCl buffer (pH 7.5), 0.1 M NaCl |
| Gene ID (Entrez) | 6622 |
| Molecular Weight (g/mol) | 14.4kDa |
| Name | Synuclein-alpha Protein |
| Purification Method | Protein |
| Quantity | 0.1 mg |
| Source | E. Coli |
| Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction