Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human AlphaB Crystallin/CRYAB Protein
SDP

Catalog No. NBC118352
Click to view available options
:
0.1mg; Unlabeled

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-175 of Human AlphaB Crystallin/CRYAB The Recombinant Human AlphaB Crystallin/CRYAB Protein is derived from E. coli. The Recombinant Human AlphaB Crystallin/CRYAB Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_001876.1
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 7.5), 50mM NaCl, 1mM EDTA
Gene ID (Entrez) 1410
Molecular Weight (g/mol) 20.1kDa
Name AlphaB Crystallin/CRYAB protein
Purification Method Protein
Immunogen MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.