Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBP22655020

Novus Biologicals™ Recombinant Human IFN-alpha 1 Protein
SDP

Catalog No. NBP22655020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP22655020 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP22655020 Supplier Novus Biologicals™ Supplier No. NBP22655020UG

Description

Highly purified and high bioactivity. Generating reliable and reproducible results.

Recombinant biologically active Interferon alpha protein. Source:E. coli Amino Acid Sequence: MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE The Recombinant Human IFN-alpha 1 Protein is derived from E. coli. The Recombinant Human IFN-alpha 1 Protein has been validated for the following applications: Bioactivity.

Specifications

Gene ID (Entrez) 3439
Name Interferon alpha Protein
Purification Method SDS-PAGE
Quantity 20 μg
Storage Requirements 4°C short term, −20°C long term. Avoid freeze-thaw cycles.
Cross Reactivity Human
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.