Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118469

Novus Biologicals™ Recombinant Human IRF3 Protein
SDP

Catalog No. NBC118469
Click to view available options
:
0.1mg; Unlabeled

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-112 of Human IRF3 The Recombinant Human IRF3 Protein is derived from E. coli. The Recombinant Human IRF3 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_001562
For Use With (Application) ELISA, SDS-PAGE
Formulation PBS (pH 7.4)
Gene ID (Entrez) 3661
Molecular Weight (g/mol) 13kDa
Name IRF3 Protein
Purification Method Protein
Immunogen MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.