Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118486

Novus Biologicals™ Recombinant Mouse SCF/c-kit Ligand Protein
SDP

Catalog No. NBC118486
Click to view available options
:
0.1mg; Unlabeled

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 26-189 of mouse SCF/c-kit Ligand The Recombinant Mouse SCF/c-kit Ligand Protein is derived from E. coli. The Recombinant Mouse SCF/c-kit Ligand Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation PBS (pH 7.4), 10% glycerol
Gene ID (Entrez) 4254
Molecular Weight (g/mol) 18kDa
Name SCF/c-kit Ligand Protein
Purification Method Protein
Immunogen MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Mouse
Purity or Quality Grade >95%, by SDS-PAGE
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.