Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NB19930410U

Novus Biologicals™ Recombinant Mouse VEGF 121 Protein
SDP

Catalog No. NB19930410U Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
10 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB19930410U 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB19930410U Supplier Novus Biologicals™ Supplier No. NBP19930410UG

Description

Highly purified and high bioactivity. Generating reliable and reproducible results.

  • Recombinant bioactive protein for Mouse VEGF 121
  • The Recombinant Mouse VEGF 121 Protein is derived from E. coli.
  • Amino Acid Sequence:(Q00731) - MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
  • The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/mL
  • This product is for research use only and is not approved for use in humans or in clinical diagnosis.

Specifications

Concentration Lyoph
For Use With (Application) Bioactivity, SDS-PAGE
Gene ID (Entrez) 7422
Molecular Weight (g/mol) 28.2 kDa
Purification Method >97%, by SDS-PAGE
Quantity 10 μg
Source E. coli
Storage Requirements Store at -20 to -80°C. Avoid freeze-thaw cycles.
Endotoxin Concentration <0.1 ng/μg
Gene Symbol VEGFA
Reconstitution Reconstitute the lyophilized product with sterile H2O at a concentration of 0.1 - 0.5 mg/mL, which can be further diluted into other aqueous solutions
Buffer Sterile filtered and lyophilized with no additives
Purity or Quality Grade >97%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.