Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RECQ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257572
Description
RECQ1 Polyclonal specifically detects RECQ1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
RECQ1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
DNA helicase, RecQ-like type 1, DNA-dependent ATPase Q1, EC 3.6.1, EC 3.6.4.12, RecQ protein-like (DNA helicase Q1-like), RecQ protein-like 1, RECQ1, RecQ1ATP-dependent DNA helicase Q1, RecQL1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
RECQL | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQ | |
100 μL | |
DNA Repair | |
5965 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction