REEP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162374

Catalog No. NBP162374

Description

REEP1 Polyclonal specifically detects REEP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: REEP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C2orf23, chromosome 2 open reading frame 23, receptor accessory protein 1, receptor expression-enhancing protein 1, SPG31FLJ13110
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H902
• Gene Symbols: REEP1
• Immunogen: Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the middle region of REEP1. Peptide sequence AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 65055
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only