REEP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP237919

Catalog No. NBP237919

Description

REEP6 Polyclonal specifically detects REEP6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: REEP6
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q96HR9
• Gene Symbols: REEP6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C19orf32deleted in polyposis 1-like 1, DP1L1chromosome 19 open reading frame 32, FLJ25383, Polyposis locus protein 1-like 1, receptor accessory protein 6, receptor expression enhancing protein 6, receptor expression-enhancing protein 6, TB2L1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 92840
• Target Species: Human
• Isotype: IgG