Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Reg3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Reg3A |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Reg3A Polyclonal specifically detects Reg3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Reg3A | |
Polyclonal | |
Rabbit | |
Human | |
hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III | |
REG3A | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5068 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title