Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Reg4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | Reg4 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Reg4 Polyclonal specifically detects Reg4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Reg4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9BYZ8 | |
| 83998 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Gastrointestinal secretory protein, GISPREG-4, Reg IV, regenerating gene type IV, regenerating islet-derived family, member 4, regenerating islet-derived protein 4, Regenerating islet-derived protein IV, REG-IV, RELPREG-like protein | |
| REG4 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Reg4 Antibody, Novus Biologicals™