RelA/NFkB p65 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP256067	Novus Biologicals NBP256067	100 μL
NB394670	Novus Biologicals NBP25606725UL	25 μL

Description

RelA/NFkB p65 Polyclonal specifically detects RelA/NFkB p65 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RelA/NFkB p65
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Innate Immunity, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5970
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: MGC131774, nf kb p65, NFkB p65, NF-kB p65, NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65)), Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65, p65, RelA, rela p65, v-rel reticuloendotheliosis viral oncogene homolog A (avian), v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65
• Gene Symbols: RELA
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only