Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RENT1/UPF1/hUPF1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200042142 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405877 25 μL
NBP189641 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405877 Supplier Novus Biologicals Supplier No. NBP18964125UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

RENT1/UPF1/hUPF1 Polyclonal specifically detects RENT1/UPF1/hUPF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen RENT1/UPF1/hUPF1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog
Gene Symbols UPF1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA Repair, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 5976
Test Specificity Specificity of human RENT1/UPF1/hUPF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.