Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RERG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RERG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RERG Polyclonal specifically detects RERG in Human samples. It is validated for Western Blot.Specifications
RERG | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
MGC15754, RAS-like, estrogen-regulated, growth inhibitor, ras-related and estrogen-regulated growth inhibitor | |
RERG | |
IgG | |
22 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q96A58 | |
85004 | |
Synthetic peptides corresponding to RERG (RAS-like, estrogen-regulated, growth inhibitor) The peptide sequence was selected from the C terminal of RERG. Peptide sequence CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title