Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Reticulon 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15966220UL
Description
Reticulon 2 Polyclonal specifically detects Reticulon 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Reticulon 2 | |
Polyclonal | |
Western Blot 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
A8K7F2 | |
RTN2 | |
Synthetic peptides corresponding to RTN2(reticulon 2) The peptide sequence was selected from the N terminal of RTN2. Peptide sequence MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE. | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSP2, NSPL1NSP-like protein 1, NSPLI, NSP-like protein I, reticulon 2, reticulon-2 | |
Rabbit | |
51 kDa | |
20 μL | |
Neuroscience | |
6253 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction