Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
retinol dehydrogenase 8 (all trans) Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317534100UL
This item is not returnable.
View return policy
Description
retinol dehydrogenase 8 (all trans) Polyclonal antibody specifically detects retinol dehydrogenase 8 (all trans) in Human samples. It is validated for ImmunofluorescenceSpecifications
| retinol dehydrogenase 8 (all trans) | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| photoreceptor outer segment all-trans retinol dehydrogenase, PRRDH, retinol dehydrogenase 8, retinol dehydrogenase 8 (all-trans), SDR28C2, short chain dehydrogenase/reductase family 28C, member 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 50700 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction