RFC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB395929	Novus Biologicals NBP24892725UL	25 μL

Description

RFC4 Polyclonal antibody specifically detects RFC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RFC4
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication, DNA Repair
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene ID (Entrez): 5984
• Isotype: IgG
• Purification Method: Immunogen affinity purified

• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: A1, A1 37 kDa subunit, Activator 1 37 kDa subunit, Activator 1 subunit 4, MGC27291, replication factor C (activator 1) 4, 37kDa, Replication factor C 37 kDa subunit, replication factor C subunit 4, RFC 37 kDa subunit, RF-C 37 kDa subunit, RFC37replication factor C (activator 1) 4 (37kD)
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.